Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit

Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit

Contact us to Order: [email protected]

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx116407	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx025620-400ul	Abbexa	400 ul	EUR 523

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx025620-80l	Abbexa	80 µl	EUR 286

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx239145-100ug	Abbexa	100 ug	EUR 509

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx175011	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx331387-100ul	Abbexa	100 ul	EUR 425

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx326557	Abbexa	EUR 314.00 EUR 244.00	100 ug 50 ug

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx334128	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Protein
20-abx166180	Abbexa	EUR 690.00 EUR 286.00 EUR 2124.00 EUR 815.00 EUR 495.00	100 ug 10 ug 1 mg 200 ug 50 ug

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
4-SEE592Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
abx253336-96tests	Abbexa	96 tests	EUR 707

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
20-abx153419	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests

Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit
EH3935	FN Test	96T	EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (HRP)
20-abx338206	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (FITC)
20-abx338207	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (Biotin)
20-abx338208	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) CLIA Kit
20-abx494660	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests

Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) CLIA Kit
abx197874-96tests	Abbexa	96 tests	EUR 825

ELISA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
E-EL-H2371	Elabscience Biotech	1 plate of 96 wells	EUR 534
Description: A sandwich ELISA kit for quantitative measurement of Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
ELK4664	ELK Biotech	1 plate of 96 wells	EUR 432
Description: A sandwich ELISA kit for detection of Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human)
4-PAE592Hu01	Cloud-Clone	EUR 247.00 EUR 2510.00 EUR 625.00 EUR 310.00 EUR 214.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52)

CLIA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
E-CL-H1378	Elabscience Biotech	1 plate of 96 wells	EUR 584
Description: A sandwich CLIA kit for quantitative measurement of Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) in samples from Serum, Plasma, Cell supernatant

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), APC
4-PAE592Hu01-APC	Cloud-Clone	EUR 345.00 EUR 3275.00 EUR 912.00 EUR 440.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with APC.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), Biotinylated
4-PAE592Hu01-Biotin	Cloud-Clone	EUR 311.00 EUR 2460.00 EUR 727.00 EUR 381.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with Biotin.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), Cy3
4-PAE592Hu01-Cy3	Cloud-Clone	EUR 419.00 EUR 4325.00 EUR 1175.00 EUR 545.00 EUR 251.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with Cy3.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), FITC
4-PAE592Hu01-FITC	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with FITC.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), HRP
4-PAE592Hu01-HRP	Cloud-Clone	EUR 316.00 EUR 2855.00 EUR 807.00 EUR 398.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with HRP.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), PE
4-PAE592Hu01-PE	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with PE.

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), APC-Cy7
4-PAE592Hu01-APC-Cy7	Cloud-Clone	EUR 571.00 EUR 6430.00 EUR 1705.00 EUR 760.00 EUR 319.00	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with APC-Cy7.

Human Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-38840h	Lifescience Market	96 Tests	EUR 824

Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin-60S Ribosomal Protein L40 (UBA52) ELISA Kit
abx392092-96tests	Abbexa	96 tests	EUR 911

Mouse Ubiquitin-60S Ribosomal Protein L40 (UBA52) ELISA Kit
abx390815-96tests	Abbexa	96 tests	EUR 911

Porcine Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-22044p	Lifescience Market	96 Tests	EUR 928

Chicken Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-41366c	Lifescience Market	96 Tests	EUR 928

Mouse Ubiquitin- 60S ribosomal protein L40, Uba52 ELISA KIT
ELI-18471m	Lifescience Market	96 Tests	EUR 865

Bovine Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-30301b	Lifescience Market	96 Tests	EUR 928

Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-48T	Abbkine	48T	EUR 332
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-96T	Abbkine	96T	EUR 539
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Uba52 ELISA Kit| Rat Ubiquitin-60S ribosomal protein L40 ELISA
EF019452	Lifescience Market	96 Tests	EUR 689

Uba52 ELISA Kit| Mouse Ubiquitin-60S ribosomal protein L40 ELIS
EF016459	Lifescience Market	96 Tests	EUR 689

UBA52 ELISA Kit| Bovine Ubiquitin-60S ribosomal protein L40 ELI
EF012007	Lifescience Market	96 Tests	EUR 689

UBA52 ELISA Kit| chicken Ubiquitin-60S ribosomal protein L40 EL
EF012553	Lifescience Market	96 Tests	EUR 689

Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed
ELISA-1	Alpha Diagnostics	1	EUR 202

Ubiquitin Fusion Degradation 1 Like Protein
20-abx262677	Abbexa	EUR 328.00 EUR 6397.00 EUR 230.00	10 ug 1 mg 2 µg

Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit
CSB-EL025559HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Ubiquitin fusion degradation protein 1 homolog (UFD1L) in samples from serum, plasma, tissue homogenates, cell lysates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit
1-CSB-EL025559HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Ubiquitin fusion-degradation 1-like protein (UFD1L) ELISA Kit
abx384111-96tests	Abbexa	96 tests	EUR 911

Human Ubiquitin fusion degradation protein 1 homolog (UFD1L)
1-CSB-EP842166HU	Cusabio	EUR 380.00 EUR 214.00 EUR 1309.00 EUR 560.00 EUR 873.00 EUR 262.00	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) expressed in E.coli

Anti-Human Chorionic Gonadotropin Antibody Clone HCGab/52, Unconjugated-100ug
MSM1-52-P1	EnQuireBio	100ug	EUR 428

Uba52/ Rat Uba52 ELISA Kit
ELI-41132r	Lifescience Market	96 Tests	EUR 886

ANA (Antinuclear Antibody IgG) ELISA test
52	Biobase	96T/Box	Ask for price
Description: ELISA based test for quantitative detection of ANA (Antinuclear Antibody IgG)

UFD1L Ubiquitin Fusion Degradation 1 Like Human Recombinant Protein
PROTQ92890	BosterBio	Regular: 10ug	EUR 317
Description: UFD1L Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 330 amino acids (1-307) and having a molecular mass of 36.9kDa.

UBA52 ELISA KIT|Human
EF007238	Lifescience Market	96 Tests	EUR 689

Sulfonamides Residue ELISA kit
55R-2234	Fitzgerald	1 kit	EUR 766
Description: Sulfonamides Residue ELISA kit for use in research laboratory

Sulfonamides residue ELISA Kit
K4207-100	Biovision		EUR 881

Ubiquitin Fusion Degradation 1 Like (Yeast) Antibody
20-abx116417	Abbexa	EUR 732.00 EUR 398.00	150 ul 50 ul

SS-A 52 Antibody IgG ELISA Kit
DEIA1686	Creative Diagnostics	96T	EUR 840
Description: Anti-SS-A 52 is an indirect solid phase enzyme immunoassay (ELISA) for measurement of IgG class autoantibodies to SS-A 52 in human serum or plasma.

UBA52 ELISA Kit (Human) (OKCD01827)
OKCD01827	Aviva Systems Biology	96 Wells	EUR 831
Description: Description of target: Ubiquitin: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. 60S ribosomal protein L40: Component of the 60S subunit of the ribosome. Ribosomal protein L40 is essential for translation of a subset of cellular transcripts, and especially for cap-dependent translation of vesicular stomatitis virus mRNAs. ;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: < 0.116 ng/mL

Human Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-42809h	Lifescience Market	96 Tests	EUR 824

Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-15206h	Lifescience Market	96 Tests	EUR 824

Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Canine UBA52 ELISA KIT
ELI-14494d	Lifescience Market	96 Tests	EUR 928

DiscoveryProbe? Natural Product Library
L1039-.1	ApexBio	100 uL/well(10 mM solution)	EUR 4608

Thiamphenicol drug residue ELISA Kit
DEIANJ33	Creative Diagnostics	96T	EUR 866
Description: Thiamphenicol drug residue ELISA Kit is intended for the quantitative determination of Thiamphenicol drug residue in raw milk, egg, seafood, tissue.

Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
SP-55426-1	Alpha Diagnostics	0.5 mg	EUR 663

Recombinant Human RO-52/SS-A
7-06166	CHI Scientific	10µg	Ask for price

Recombinant Human RO-52/SS-A
7-06167	CHI Scientific	50µg	Ask for price

Recombinant Human RO-52/SS-A
7-06168	CHI Scientific	1mg	Ask for price

Human Lipoprotein a [Lp(a)] AssayMax ELISA Kit
EL3001-1	AssayPro	96 Well Plate	EUR 396

UBA52 Recombinant Protein (Human)
RP106097	ABM	100 ug	Ask for price

RPS27A Ubiquitin Human Recombinant Protein
PROTP62988-1	BosterBio	Regular: 50ug	EUR 317
Description: Ubiquitin Human Recombinant expressed in E.coli and purified by ion-exchange chromatography, contains 76 amino acids and has an Mw of 8.6kDa.

Rabbit Anti-Thioredoxin (TrxA, E. coli, fusion protein) IgG
THRX11-A	Alpha Diagnostics	100 ug	EUR 482

Rabbit Anti-Maltose binding protein (MBP) (fusion tag) IgG
MBP12-A	Alpha Diagnostics	100 ug	EUR 482

DiscoveryProbe? Natural Product Library Plus
L1049-.1	ApexBio	100 uL/well(10 mM solution)	EUR 3527

Mouse Vacuolar fusion protein MON1 homolog A, Mon1a ELISA KIT
ELI-23201m	Lifescience Market	96 Tests	EUR 865

Bovine Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-46330b	Lifescience Market	96 Tests	EUR 928

Chicken Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-38759c	Lifescience Market	96 Tests	EUR 928

Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Adrenomedullin (1-52), human
5-00620	CHI Scientific	4 x 1mg	Ask for price

Human Vacuolar fusion protein MON1 homolog A (MON1A)
1-CSB-EP801242HU	Cusabio	EUR 380.00 EUR 214.00 EUR 1309.00 EUR 560.00 EUR 873.00 EUR 262.00	100ug 10ug 1MG 200ug 500ug 50ug
Description: Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A),partial expressed in E.coli

Bovine Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-36320b	Lifescience Market	96 Tests	EUR 928

Chicken Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-18599c	Lifescience Market	96 Tests	EUR 928

Mouse Ubiquitin- 40S ribosomal protein S27a, Rps27a ELISA KIT
ELI-38700m	Lifescience Market	96 Tests	EUR 865

Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-192T	BlueGene	192 tests	EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-48	BlueGene	1 plate of 48 wells	EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-96	BlueGene	1 plate of 96 wells	EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Fusion (FUS) ELISA Kit
SEC260Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.

Human Fusion (FUS) ELISA Kit
SEC260Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.

Human Fusion (FUS) ELISA Kit
SEC260Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.

Human Fusion (FUS) ELISA Kit
SEC260Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.

Human Fusion (FUS) ELISA Kit
4-SEC260Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Fusion (FUS) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Fusion (FUS) ELISA Kit
RD-FUS-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Fusion (FUS) ELISA Kit
RD-FUS-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Fusion (FUS) ELISA Kit
DLR-FUS-Hu-48T	DL Develop	48T	EUR 517
Description: A sandwich quantitative ELISA assay kit for detection of Human Fusion (FUS) in samples from tissue homogenates or other biological fluids.

Human Fusion (FUS) ELISA Kit
DLR-FUS-Hu-96T	DL Develop	96T	EUR 673
Description: A sandwich quantitative ELISA assay kit for detection of Human Fusion (FUS) in samples from tissue homogenates or other biological fluids.

Human Fusion (FUS) ELISA Kit
20-abx151603	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests

Human Fusion ELISA Kit (FUS)
RK01425	Abclonal	96 Tests	EUR 521

Human Fusion (FUS) ELISA Kit
RDR-FUS-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Fusion (FUS) ELISA Kit
RDR-FUS-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Fusion(FUS)ELISA Kit
QY-E01737	Qayee Biotechnology	96T	EUR 361

Human Transmembrane protein 52, TMEM52 ELISA KIT
ELI-16312h	Lifescience Market	96 Tests	EUR 824

Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit