Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit

Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit

Contact us to Order: [email protected]

Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx116407
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx025620-400ul 400 ul
EUR 523
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx025620-80l 80 µl
EUR 286
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx239145-100ug 100 ug
EUR 509
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx175011
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
abx331387-100ul 100 ul
EUR 425
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx326557
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody
20-abx334128
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Protein
20-abx166180
  • EUR 690.00
  • EUR 286.00
  • EUR 2124.00
  • EUR 815.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
SEE592Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in Tissue homogenates and other biological fluids.
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
4-SEE592Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
abx253336-96tests 96 tests
EUR 707
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) ELISA Kit
20-abx153419
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit
EH3935 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (HRP)
20-abx338206
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (FITC)
20-abx338207
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Antibody (Biotin)
20-abx338208
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) CLIA Kit
20-abx494660
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) CLIA Kit
abx197874-96tests 96 tests
EUR 825
ELISA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
E-EL-H2371 1 plate of 96 wells
EUR 534
Description: A sandwich ELISA kit for quantitative measurement of Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
ELK4664 1 plate of 96 wells
EUR 432
Description: A sandwich ELISA kit for detection of Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human)
4-PAE592Hu01
  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52)
CLIA kit for Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1)
E-CL-H1378 1 plate of 96 wells
EUR 584
Description: A sandwich CLIA kit for quantitative measurement of Human UBA52 (Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) in samples from Serum, Plasma, Cell supernatant
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), APC
4-PAE592Hu01-APC
  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with APC.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), Biotinylated
4-PAE592Hu01-Biotin
  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with Biotin.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), Cy3
4-PAE592Hu01-Cy3
  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with Cy3.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), FITC
4-PAE592Hu01-FITC
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with FITC.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), HRP
4-PAE592Hu01-HRP
  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with HRP.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), PE
4-PAE592Hu01-PE
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with PE.
Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52) Polyclonal Antibody (Human), APC-Cy7
4-PAE592Hu01-APC-Cy7
  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1 (UBA52). This antibody is labeled with APC-Cy7.
Human Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-38840h 96 Tests
EUR 824
Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E01U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin-60S Ribosomal Protein L40 (UBA52) ELISA Kit
abx392092-96tests 96 tests
EUR 911
Mouse Ubiquitin-60S Ribosomal Protein L40 (UBA52) ELISA Kit
abx390815-96tests 96 tests
EUR 911
Porcine Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-22044p 96 Tests
EUR 928
Chicken Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-41366c 96 Tests
EUR 928
Mouse Ubiquitin- 60S ribosomal protein L40, Uba52 ELISA KIT
ELI-18471m 96 Tests
EUR 865
Bovine Ubiquitin- 60S ribosomal protein L40, UBA52 ELISA KIT
ELI-30301b 96 Tests
EUR 928
Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E08U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E09U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E07U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E02U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E06U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E04U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E03U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-48T 48T
EUR 332
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-5platesof96wells 5 plates of 96 wells
EUR 2115
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Human Ubiquitin-60S ribosomal protein L40 (UBA52)
KTE62310-96T 96T
EUR 539
Description: Quantitative sandwich ELISA for measuring Human Ubiquitin-60S ribosomal protein L40 (UBA52) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
Uba52 ELISA Kit| Rat Ubiquitin-60S ribosomal protein L40 ELISA
EF019452 96 Tests
EUR 689
Uba52 ELISA Kit| Mouse Ubiquitin-60S ribosomal protein L40 ELIS
EF016459 96 Tests
EUR 689
UBA52 ELISA Kit| Bovine Ubiquitin-60S ribosomal protein L40 ELI
EF012007 96 Tests
EUR 689
UBA52 ELISA Kit| chicken Ubiquitin-60S ribosomal protein L40 EL
EF012553 96 Tests
EUR 689
Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) ELISA kit
E05U0041-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Guinea pig Ubiquitin 60S ribosomal protein L40(UBA52) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed
ELISA-1 1
EUR 202
Ubiquitin Fusion Degradation 1 Like Protein
20-abx262677
  • EUR 328.00
  • EUR 6397.00
  • EUR 230.00
  • 10 ug
  • 1 mg
  • 2 µg
Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit
CSB-EL025559HU-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human Ubiquitin fusion degradation protein 1 homolog (UFD1L) in samples from serum, plasma, tissue homogenates, cell lysates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) ELISA kit
1-CSB-EL025559HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Ubiquitin fusion-degradation 1-like protein (UFD1L) ELISA Kit
abx384111-96tests 96 tests
EUR 911
Human Ubiquitin fusion degradation protein 1 homolog (UFD1L)
1-CSB-EP842166HU
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Ubiquitin fusion degradation protein 1 homolog(UFD1L) expressed in E.coli
Anti-Human Chorionic Gonadotropin Antibody Clone HCGab/52, Unconjugated-100ug
MSM1-52-P1 100ug
EUR 428
Uba52/ Rat Uba52 ELISA Kit
ELI-41132r 96 Tests
EUR 886
ANA (Antinuclear Antibody IgG) ELISA test
52 96T/Box Ask for price
Description: ELISA based test for quantitative detection of ANA (Antinuclear Antibody IgG)
UFD1L Ubiquitin Fusion Degradation 1 Like Human Recombinant Protein
PROTQ92890 Regular: 10ug
EUR 317
Description: UFD1L Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 330 amino acids (1-307) and having a molecular mass of 36.9kDa.
UBA52 ELISA KIT|Human
EF007238 96 Tests
EUR 689
Sulfonamides Residue ELISA kit
55R-2234 1 kit
EUR 766
Description: Sulfonamides Residue ELISA kit for use in research laboratory
Sulfonamides residue ELISA Kit
K4207-100
EUR 881
Ubiquitin Fusion Degradation 1 Like (Yeast) Antibody
20-abx116417
  • EUR 732.00
  • EUR 398.00
  • 150 ul
  • 50 ul
SS-A 52 Antibody IgG ELISA Kit
DEIA1686 96T
EUR 840
Description: Anti-SS-A 52 is an indirect solid phase enzyme immunoassay (ELISA) for measurement of IgG class autoantibodies to SS-A 52 in human serum or plasma.
UBA52 ELISA Kit (Human) (OKCD01827)
OKCD01827 96 Wells
EUR 831
Description: Description of target: Ubiquitin: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD (endoplasmic reticulum-associated degradation) and in cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is involved in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. 60S ribosomal protein L40: Component of the 60S subunit of the ribosome. Ribosomal protein L40 is essential for translation of a subset of cellular transcripts, and especially for cap-dependent translation of vesicular stomatitis virus mRNAs. ;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: < 0.116 ng/mL
Human Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-42809h 96 Tests
EUR 824
Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E01V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-15206h 96 Tests
EUR 824
Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E01U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Canine UBA52 ELISA KIT
ELI-14494d 96 Tests
EUR 928
DiscoveryProbe? Natural Product Library
L1039-.1 100 uL/well(10 mM solution)
EUR 4608
Thiamphenicol drug residue ELISA Kit
DEIANJ33 96T
EUR 866
Description: Thiamphenicol drug residue ELISA Kit is intended for the quantitative determination of Thiamphenicol drug residue in raw milk, egg, seafood, tissue.
Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
SP-55426-1 0.5 mg
EUR 663
Recombinant Human RO-52/SS-A
7-06166 10µg Ask for price
Recombinant Human RO-52/SS-A
7-06167 50µg Ask for price
Recombinant Human RO-52/SS-A
7-06168 1mg Ask for price
Human Lipoprotein a [Lp(a)] AssayMax ELISA Kit
EL3001-1 96 Well Plate
EUR 396
UBA52 Recombinant Protein (Human)
RP106097 100 ug Ask for price
RPS27A Ubiquitin Human Recombinant Protein
PROTP62988-1 Regular: 50ug
EUR 317
Description: Ubiquitin Human Recombinant expressed in E.coli and purified by ion-exchange chromatography, contains 76 amino acids and has an Mw of 8.6kDa.
Rabbit Anti-Thioredoxin (TrxA, E. coli, fusion protein) IgG
THRX11-A 100 ug
EUR 482
Rabbit Anti-Maltose binding protein (MBP) (fusion tag) IgG
MBP12-A 100 ug
EUR 482
DiscoveryProbe? Natural Product Library Plus
L1049-.1 100 uL/well(10 mM solution)
EUR 3527
Mouse Vacuolar fusion protein MON1 homolog A, Mon1a ELISA KIT
ELI-23201m 96 Tests
EUR 865
Bovine Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-46330b 96 Tests
EUR 928
Chicken Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-38759c 96 Tests
EUR 928
Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E08V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E09V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E07V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E02V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E06V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E04V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Vacuolar fusion protein MON1 homolog A(MON1A) ELISA kit
E03V0065-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Vacuolar fusion protein MON1 homolog A(MON1A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Adrenomedullin (1-52), human
5-00620 4 x 1mg Ask for price
Human Vacuolar fusion protein MON1 homolog A (MON1A)
1-CSB-EP801242HU
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 100ug
  • 10ug
  • 1MG
  • 200ug
  • 500ug
  • 50ug
Description: Recombinant Human Vacuolar fusion protein MON1 homolog A(MON1A),partial expressed in E.coli
Bovine Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-36320b 96 Tests
EUR 928
Chicken Ubiquitin- 40S ribosomal protein S27a, RPS27A ELISA KIT
ELI-18599c 96 Tests
EUR 928
Mouse Ubiquitin- 40S ribosomal protein S27a, Rps27a ELISA KIT
ELI-38700m 96 Tests
EUR 865
Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E08U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Canine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E09U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E07U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E02U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E06U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Goat Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E04U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) ELISA kit
E03U0039-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse Ubiquitin 40S ribosomal protein S27a(RPS27A) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Fusion (FUS) ELISA Kit
SEC260Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.
Human Fusion (FUS) ELISA Kit
SEC260Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.
Human Fusion (FUS) ELISA Kit
SEC260Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.
Human Fusion (FUS) ELISA Kit
SEC260Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Fusion (FUS) in tissue homogenates, cell lysates and other biological fluids.
Human Fusion (FUS) ELISA Kit
4-SEC260Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Fusion (FUS) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Fusion (FUS) ELISA Kit
RD-FUS-Hu-48Tests 48 Tests
EUR 521
Human Fusion (FUS) ELISA Kit
RD-FUS-Hu-96Tests 96 Tests
EUR 723
Human Fusion (FUS) ELISA Kit
DLR-FUS-Hu-48T 48T
EUR 517
Description: A sandwich quantitative ELISA assay kit for detection of Human Fusion (FUS) in samples from tissue homogenates or other biological fluids.
Human Fusion (FUS) ELISA Kit
DLR-FUS-Hu-96T 96T
EUR 673
Description: A sandwich quantitative ELISA assay kit for detection of Human Fusion (FUS) in samples from tissue homogenates or other biological fluids.
Human Fusion (FUS) ELISA Kit
20-abx151603
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
Human Fusion ELISA Kit (FUS)
RK01425 96 Tests
EUR 521
Human Fusion (FUS) ELISA Kit
RDR-FUS-Hu-48Tests 48 Tests
EUR 544
Human Fusion (FUS) ELISA Kit
RDR-FUS-Hu-96Tests 96 Tests
EUR 756
Human Fusion(FUS)ELISA Kit
QY-E01737 96T
EUR 361
Human Transmembrane protein 52, TMEM52 ELISA KIT
ELI-16312h 96 Tests
EUR 824

Human UBA52(Ubiquitin A 52 Residue Ribosomal Protein Fusion Product 1) ELISA Kit